PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013634909.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 467aa    MW: 52291 Da    PI: 5.7628
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013634909.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.49.1e-151562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WTt Ed +l ++v++ G g+W+++ +  g+ R++k+c++rw ++l
   XP_013634909.1 15 KGPWTTTEDAILTEYVRKRGEGNWNAVQKNSGLLRCGKSCRLRWANHL 62
                     79******************************99**********9986 PP

2Myb_DNA-binding48.91.5e-1569111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g+++++E++++++++++lG++ W++ a+ ++ gRt++++k++w++
   XP_013634909.1  69 GSFSPDEEKIIIELHAKLGNK-WARMASQLP-GRTDNEIKNYWNT 111
                      89*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.1021062IPR017930Myb domain
SuperFamilySSF466893.16E-2812109IPR009057Homeodomain-like
SMARTSM007173.2E-111464IPR001005SANT/Myb domain
PfamPF002497.4E-131562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-201669IPR009057Homeodomain-like
CDDcd001671.46E-81762No hitNo description
PROSITE profilePS5129423.56163117IPR017930Myb domain
SMARTSM007171.5E-1467115IPR001005SANT/Myb domain
PfamPF002491.0E-1468111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.3E-2470116IPR009057Homeodomain-like
CDDcd001673.33E-1170111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009555Biological Processpollen development
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0090406Cellular Componentpollen tube
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 467 aa     Download sequence    Send to blast
MDGGEETSTA RGLKKGPWTT TEDAILTEYV RKRGEGNWNA VQKNSGLLRC GKSCRLRWAN  60
HLRPNLRTGS FSPDEEKIII ELHAKLGNKW ARMASQLPGR TDNEIKNYWN TRIKRRQRAG  120
LPLYPHEIQH LGIGNDDEFE IRCFQFPNKD HPNHQNMIQY TNSSNTSPSS SSFSSSSSQP  180
PKELCLDPLI STNPGLNQIP NMFSPYNNSF ENDNNQFVFS LPFSSSSSSN ELCNPDQLLE  240
LMSENLDTNV ISKKDIDATS LIRDHETIPS YFSLGLDTTV LELPSNQTPT QSCTSNIMLD  300
NNVRLDSPAG NSGLLDALLE ESRALSRGGI FKDARVSSSG LCEDQDKRVK MDFENRLIDH  360
LSSSHQSSFE SNSNLYEKHN EATMLKATAD DDDDMLKSLL NSFPSTTPLP DWYQTTEILK  420
EASPSGILIG HHQGNNRVEP HKPPPSSNVD PMASLGSSYW RNIPRIC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28131165107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00287DAPTransfer from AT2G32460Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013634909.10.0PREDICTED: transcription factor MYB28-like
TrEMBLA0A0D3C3N30.0A0A0D3C3N3_BRAOL; Uncharacterized protein
STRINGBra021791.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM51002747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.10.0myb domain protein 101